PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 369aa    MW: 41609 Da    PI: 6.7496
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011031genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.5e-151766148
                     TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +lvd+++   g+  +Wk+ ++  g+ R++k+c++rw +yl
      Lus10011031 17 KGPWTVEEDSKLVDYIANKKGRhaNWKLLPKLAGLDRCGKSCRLRWTNYL 66
                     79**********************************************97 PP

2Myb_DNA-binding51.81.8e-1672116147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg + +eE+ l+vd++k lG++ W++Ia +++ gRt++++k++++++
      Lus10011031  72 RGGFDEEEERLIVDLHKALGNK-WSRIATHLP-GRTDNEIKNYYNTH 116
                      67899*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8671266IPR017930Myb domain
SMARTSM007172.5E-91668IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-2516113IPR009057Homeodomain-like
PfamPF002491.4E-121766IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-201873IPR009057Homeodomain-like
CDDcd001679.13E-81966No hitNo description
PROSITE profilePS5129424.36467121IPR017930Myb domain
SMARTSM007171.3E-1571119IPR001005SANT/Myb domain
PfamPF002493.4E-1472116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2574121IPR009057Homeodomain-like
CDDcd001679.41E-1275117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MVRPPCCGEE DKMIVKKGPW TVEEDSKLVD YIANKKGRHA NWKLLPKLAG LDRCGKSCRL  60
RWTNYLRPGI KRGGFDEEEE RLIVDLHKAL GNKWSRIATH LPGRTDNEIK NYYNTHIRRK  120
LLRMGIDPHT HQPRTDHLHQ QQDIANQIVN FSQMIGAANQ LSNIMNIDSS SSSTLNILEN  180
LRVAASTTMQ QRVVTHFVLQ QLLFNNNQTA SHSPPLLLQG QDSAPTRILS LEDQLLLLAR  240
VLNPVVNLTT TDYQKSVYKP FHLSIADNND KSKSENDVKT LIVKKELMLP ELASCEASPE  300
TSSSSLVHSN HQENDHCSNF PDKTPTLFDS PVASIDIDSQ LEAWERLLMM DDDFTGGDGF  360
FSSTWTDG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-28171217108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-67myb domain protein 9